Archive for Carp Addict Forum Carp Addict Magazine - For the serious Angler.
 



       Carp Addict Forum Forum Index -> Addict Football Chat
Steve Howard

Catch us if ya can!

1 Chelsea 1 1 0 0 4 0 0 0 0 0 0 4 3    
2 Aston Villa 1 1 0 0 4 2 0 0 0 0 0 2 3
3 Bolton 1 1 0 0 3 1 0 0 0 0 0 2 3
4 Blackburn 1 0 0 0 0 0 1 0 0 3 2 1 3
5 Hull 1 1 0 0 2 1 0 0 0 0 0 1 3  
6 Middlesbrough 1 1 0 0 2 1 0 0 0 0 0 1 3
7 West Ham 1 1 0 0 2 1 0 0 0 0 0 1 3
8 Arsenal 1 1 0 0 1 0 0 0 0 0 0 1 3
9 Liverpool 1 0 0 0 0 0 1 0 0 1 0 1 3
10 Man Utd 1 0 1 0 1 1 0 0 0 0 0 0 1
11 Newcastle 1 0 0 0 0 0 0 1 0 1 1 0 1
stix

Hull will  
Steve Howard

I was just 'fishing' Stix... not had a bite yet though!  LOL  LOL

All quiet, innit?... must mean manure had a bad result.  Mwraahaha  LOL  LOL

Well, if that's what happens to them when Ron-winkingcheatingslimeygrinningdivinggit-aldo is out, then you fear for them, you really do. cripes!  LOL

Thing is, they have a pretty weak squad, with several of their players being sub-standard.

Van der Sar - When a team of manures stature have to rely upon a guy like this, it shows how their standards have plummeted.

Brown - Would you 'really' put this player in your 'top four' team?  I certainly wouldn't!

Vidic - okay, a half decent player, no more than 'acceptable'

Ferdinand - sometimes good, sometimes a liability, 'acceptable' not outstanding.

Evra -  Fiery, pacey, but is he world class? Not imo.

Fletcher - Who? No way Hose, Alex is just taking a punt on him, but he's not gonna be there much longer, surely?

Carrick - Never done anything outstanding, not for me.

O'Shea - 'Rick' is another who just falls short of being a 'top four' player.

Scholes - Over the hill (and very far away! )

Giggs  - Giggs m8, please stop now - you were great, but you just can't cut it anymore!

Campbell - Perhaps the 'best forward manure have - sez it all really!

Rafael Da Silva - Potential? Maybe, but a top four team needs players who CAN, not those who 'might'

Rooney - Flashes of brilliance, but increasingly long periods of mundane

'Subs' - Possebon, Kuszczak, Neville, Evans, Gibson.  -
Wow, strikes fear in yer heart, eh! cripes!  LOL  LOL  LOL  LOL
stix

To be honest though Steve Pompey played like Acrington Stanley, hardly a test ?
Must admit Chelski do look good this season......... ouch that hurt
maple

they said on the box last night , that to date the ruski has spent 585 million  cripes!  bloody should be playing good after that amount of money  LOL  LOL
nice goal by deco .
scotcarp

£585 m cripes!  and still no success in europe cuckoo!
JAFFA

9 of those you mentioned above Steve won us the league and the European cup last year.

Your team won nothing!

We have yet to spend a penny, whereas your lot have spent fortunes yet again and changed yet another manager.

You have one good game against a very very substandard team and your world beaters.     and James was directly at fault for 2 of the "gifted" 3 goals.

Never mind buddy, its a long haul to the winning post and thats if your lot can remember where it is Teehehe  Teehehe  Teehehe

kind regards Jeff
carpcruncher

scotcarp wrote:
£585 m cripes!  and still no success in europe cuckoo!



indeed,  cripes!

just goes to show MONEY  cant buy you everything.  

all that money spent and still far from a world class team.  
Steve Howard

stix wrote:
To be honest though Steve Pompey played like Acrington Stanley, hardly a test ?
Must admit Chelski do look good this season......... ouch that hurt


Pompey not a hard test? - Yeah, rite!

They finished 8th last term, beat Manure (away) on the way to lifting the FA cup... were narrowly beaten by manure in a pre-season friendly 2-1, and lost the charity shield on pens to Manure...

I'd say that they are a pretty good side who we made to look poor, not as you suggest.

maple wrote:
they said on the box last night , that to date the ruski has spent 585 million  cripes!  bloody should be playing good after that amount of money  LOL  LOL
nice goal by deco .


"spent"... yeah, possibly, but some might see through the BS, and see it differently than how the press want to present it for YOU to believe

I think the quoted figure includes a Multi-million £ Cobham training centre, and doesn't take into account money from players sold

We spent very little, much less than our rivals, last season, and have spent only a comparitive figure to other clubs at the top again this season.

Jealousy is a terrible thing!

scotcarp wrote:
£585 m cripes!  and still no success in europe cuckoo!


Er, not strictly true... I think that there has been a good deal of money brought into the club for their success over the past few seasons

JAFFA wrote:


9 of those you mentioned above Steve won us the league and the European cup last year.

Your team won nothing!


Yes, 9, and none who will win anything this year.
"won nothing" no, maybe not, but being a manc you will only see your teams 'success' as in lifting trophies, not the tiny margin by which it was attained.

JAFFA wrote:

We have yet to spend a penny, whereas your lot have spent fortunes yet again and changed yet another manager.


Don't give me that old clap-trap m8... aren't they signing Berbatov for around 30 million??

Anyway, you spent plenty last year when we spent very little!

JAFFA wrote:

You have one good game against a very very substandard team and your world beaters.     and James was directly at fault for 2 of the "gifted" 3 goals.


Is this the "very very substandard team" who knocked you lot out of the FA cup (and won it), has beaten you 4 times in the past 5 seasons and who lost the charity sheild only on pens to you only a week ago?

JAFFA wrote:

Never mind buddy, its a long haul to the winning post and thats if your lot can remember where it is Teehehe  Teehehe  Teehehe


Let's hope for your sake that your lot can remember... it might be a long time 'til they find themselves back in the position again
maple

Quote:
Jealousy is a terrible thing!

not jelous ,just quoted the tv steve ,
manure do look quite ordinary in the two games ive seen , your chelski look better, but its one game , and if manure do steal berby from us , i think you and everyone else will struggle to beat manure , berby would make them very very good imo .as much as that hurts me to say it  
carpcruncher

Steve Howard wrote:



but being a manc you will only see your teams 'success' as in lifting trophies,



really steve,   isn't that what the seasons all about?  

i'd give up after that comment steve  LOL  LOL
Steve Howard

No, not for 99% of football fans or players it isn't... a 'season' is about enjoying the pleasure the game can bring, the high and lows, the rollercoaster that is football.
If football is 'only about the trophies' and 'success' cannot be measured by any other criteria, then football is doomed... only 1% of teams can win each season, and they are 'normally' shared between just a few clubs.

Manure fans think they have sole, god-given rights to win them, that's the real shame of it... and my point
maple

Quote:
a 'season' is about enjoying the pleasure the game can bring, the high and lows, the rollercoaster that is football.

as a spurs fan , i know all about that    LOL
Steve Howard

So do most of us Paul... that's the point mate... if we only followed our teams purely for bragging rights when they won a trophy, what would that say about us?

I have supported the blues for 44 years mate, they have history, and plenty of it, but unlike 'some' teams, they are now creating history, not living off it!  Mwraahaha  
JAFFA

I am going to bow out now, because there is lots of slant on this posting.

I seem to remember 26 years in the wilderness, I remember the old second division and I cannot seriously remember spending 585 million in a lifetime of one owner, let alone a few years of ONE!!!!!. I also remember going through a succession of managers to arrive at the holy grail, incidentally the most successful top flight manager on the planet, the longest serving premisership manager.

Never mind, your right Steve, its only a game and it lasts all season long. Lets just see how it pans out.      

Oh and despite savage rumours......Ronaldo is STILL a united player.     The ONLY players to go from old trafford, are the ones that Sir "we are not worthy" Ferguson WANTS to go

kind regards Jeff
Steve Howard

JAFFA wrote:
I am going to bow out now, because there is lots of slant on this posting.

I seem to remember 26 years in the wilderness, I remember the old second division


Yes, so can I, and you only clawed your way back due to lots and lots of money (yes, that dirty word) being spent... Just like every other 'successful' team.

JAFFA wrote:
and I cannot seriously remember spending 585 million in a lifetime of one owner, let alone a few years of ONE!!!!!.


That old chesnut, AGAIN  The money you have spent to get to where you are is far in excess of that, and the 'value' of money spent is directly relative to the time it was spent.

What you paid for Ferdinand (28 million, was it?) quite a few years ago now, is probably in line with 40 million now.
You have spent, and spent big to try to dominate football with your financial clout, so don't come crying when somebody can more than match you  Mwraahaha  


JAFFA wrote:
I also remember going through a succession of managers to arrive at the holy grail, incidentally the most successful top flight manager on the planet, the longest serving premisership manager.

Oh how droll... don't you think that the MONEY you have spent in the past 20 years has helped secure his job?


JAFFA wrote:
Never mind, your right Steve, its only a game and it lasts all season long. Lets just see how it pans out.      


See, you can talk sense if you try really hard mate!  LOL    

JAFFA wrote:
Oh and despite savage rumours......Ronaldo is STILL a united player.     The ONLY players to go from old trafford, are the ones that Sir "we are not worthy" Ferguson WANTS to go


'Rumours'???

As I read it, it was far from being rumour mate, he wanted out but was persueded to stay.

"we are not worthy"  LOL  LOL  LOL  LOL  what!!!!???

An 'average' manger could easily emulate him given the money and backing he got over the years... mind you, I seem to recall that most united fans wanted his head paraded on a long pole after his first season at the club... funny how your opinions changed so drastically once he'd spent a bit of money to improve matters... yes, money, even your 'holy one' couldn't do a thing without it... thats where the success comes from, not Alex the gum-chewer  cuckoo!
maple

Eck i'm glad i dont take football as seriously as you two  cripes!  LOL
JAFFA

maple wrote:
Eck i'm glad i dont take football as seriously as you two  cripes!  LOL


As you one Paul    

kind regards Jeff
Steve Howard

All good clean fun, just trying to put a few media-fuelled myths to bed... the ones that continually snipe at chelsea and 'overlook' any similar 'indiscretions' by their own/former clubs.

Just think, in less than 10-years, the pundits comentating on the matches we watch on TV could well be ex-chelsea players... JT, Lamps, et al... it will be refreshing to hear their 'unbiased' opinions on united, arsenal and pool, if only to create some balance... can't wait!!!  Mwraahaha  
PeteB

Chelski 'new rich kids on the block' expect everything in a matter of a couple of years... you get rid of the chosen one and appoint a donkey... defended by the great Steve, fountain of all knowledge and seer of great things.... duly sacked... you now have a good manager... lets see... this will be an interesting season once the greatest team in the UK (MUFC) get the wounded back.... LOL  LOL  LOL  LOL
Steve Howard

PeteB wrote:
Chelski 'new rich kids on the block' expect everything in a matter of a couple of years... you get rid of the chosen one and appoint a donkey... defended by the great Steve, fountain of all knowledge and seer of great things.... duly sacked... you now have a good manager... lets see... this will be an interesting season once the greatest team in the UK (MUFC) get the wounded back.... LOL  LOL  LOL  LOL


Putting your personal sarcasm aside, and ignoring the same old jibes and diatribe, it doesn't actually leave too much for me to comment on

You have NO cause for complaint on the injury front... Chelsea have just endured two successive seasons of unpresidented injuries... This year, United have their main goal threat out through injury at the start, and so do Chelsea (Drogba)... equal so far, then, except that united just haven't got the strength in depth to cover for it  shame! Mwraahaha  LOL    

       Carp Addict Forum Forum Index -> Addict Football Chat
Page 1 of 1
Create your own free forum | Buy a domain to use with your forum